PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G040100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 454aa    MW: 49773.2 Da    PI: 7.445
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G040100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.33.5e-08229271347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +W +e+ e++ + ++++G++ +++I++ +  ++t  +c+++++k+
  Seita.9G040100.1.p 229 PWRQEDKEIFMEMFAKFGKN-FSKISSFLM-HKTTADCVEFYYKH 271
                         8*****************99.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.64E-13214274IPR009057Homeodomain-like
PROSITE profilePS5129313.068225276IPR017884SANT domain
SMARTSM007174.8E-7226274IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-6227273IPR009057Homeodomain-like
PfamPF002491.4E-5229271IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MAAECEEAEE GRDGDGVAAA ASRAWRRRGL QAAHPATPVV QDCDVKGADM MEIEPAPVRN  60
AKTLSSEECS HLKASEGAGS QNDMHNDRLE TSSCHVNSDS IKIEISDDLP VTQCSDHDQK  120
YSLFGSVTSA NNNIAKVMNE SLFKSLPPDT PHLDLLASTG NLSTFSTAEM SDVASKLFSE  180
FLIKRCRNYL KMLALIIDER EKERSRFVSK NGLVDDPVLV EKERVMINPW RQEDKEIFME  240
MFAKFGKNFS KISSFLMHKT TADCVEFYYK HHKSDSFREV KKVLDLRQQQ PASNFLGAKS  300
GKKWNPEANA ASLDMLGVAS VVATHGLEYA NRVEKISAKS LIRTAYGSNV SFAAKKSSDR  360
ECIDNVPLHE RESVAADVLV GSGGSRRRRG SGGAGRRGAR VGSGEVAAEQ GSRRRGAWCV  420
GCAWCAGGGS GWEVCKVRLM CGWWEWMGGM KEP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C1e-16190278394NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D1e-16190278394NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004986160.11e-156PREDICTED: uncharacterized protein LOC101778133
TrEMBLK3Z3351e-138K3Z335_SETIT; Uncharacterized protein
TrEMBLK3Z3511e-139K3Z351_SETIT; Uncharacterized protein
STRINGSi020953m1e-137(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.18e-44MYB family protein